WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein - RP00291

Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein - RP00291

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00291-10, RP00291-20, RP00291-50, RP00291-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Gln208) of human Fc gamma RIIIB/CD16b (Accession #NP_000561.3) fused with a 6×His tag at the C-terminus.

Alternate Names: FCGR3B, CD16, CD16b, FCG3, FCGR3, FCR-10, FCRIII, FCRIIIb

SWISS: O75015

GeneID: 2215

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD16 is a low affinity Fc receptor, and has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b). These receptors function in the activation or inhibition of immune responses. CD16 encoded by two different highly homologous genes in a cell type-specific manner.CD16 is found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16B is also kown as FCGR3B and FCG3B, is expressed specifically by polymorphonuclear leukocytes (neutrophils) and stimulated eosinophils. CD16B is the low affinity receptor for the Fc region of immunoglobulins gamma. CD16B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized APC anti-human CD16 Antibody at 1μg/mL (25 μL/well) can bind Human FCGR3B with a linear range of 0.46-1.16ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only