WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human FCAR/CD89 Protein - RP00113

Recombinant Human FCAR/CD89 Protein - RP00113

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human FCAR/CD89 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP00113-10, RP00113-20, RP00113-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human FCAR/CD89 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln22-Asn227) of human CD89/FCAR (Accession #NP_001991.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: FCAR, CD89, CTB-61M7.2, FcalphaRI

SWISS: P24071

GeneID: 2204

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the immunoglobulin gene superfamily and receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGHA1 (Catalog: RPT0023) at 5 μg/mL (100 μL/well) can bind Human CD89/FCAR (Catalog: RP00113) with a linear range of 0.01-7.4 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only