Recombinant Human Fetuin A/AHSG Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00195-10, RP00195-20, RP00195-50, RP00195-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Fetuin A/AHSG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-Val367) of human Fetuin-A/AHSG/FETUA (Accession #NP_001613.2) fused with a 6×His tag at the C-terminus.
Alternate Names: AHSG, A2HS, AHS, FETUA, HSGA, alpha-2-HS-glycoprotein
SWISS: P02765
GeneID: 197
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Fetuin-A, also known as Alpha-2-HS-Glycoprotein (AHSG), belongs to the Fetuin family.It is a major plasma protein and a member of the cystatin superfamily of protease inhibitors.It is expressed by hepatocytes, the principal cell source, and by monocyte/macrophages. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues.
Bio-Activity: 1.Measured by its ability to inhibit calcium phosphate precipitation. The IC50 value is <25 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only