Recombinant human FGF-23 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01740-10, RP01740-20, RP01740-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant human FGF-23 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr25-Ile251) of human FGF-23/Fibroblast growth factor 23 (Accession #NP_065689.1) fused witha 6×His tag at the C-terminus.
Alternate Names: ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC
SWISS: Q9GZV9
GeneID: 8074
Species: human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Fibroblast growth factor 23 (FGF23) is is an endocrine member of the family of FGFs and mainly produced in the bone and, upon secretion, forms a complex with a FGF receptor and coreceptor αKlotho. FGF23 can exert several endocrine functions, such as acting as a hormone on the kidney, stimulating phosphate excretion and suppressing formation of 1,25(OH)2D3, active vitamin D. Moreover, it has paracrine activities on several cell types, including neutrophils and hepatocytes. FGF23 and phosphate have been revealed to be factors relevant in cancer. FGF23 is particularly significant for those forms of cancer primarily affecting bone (e.g., multiple myeloma) or characterized by bone metastasis.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM MOPS, 150mM NaCl, 5mM EDTA, 2mM DTT, pH 7.4
Antigen Sequence: YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only