Recombinant Human Frizzled-5/FZD5 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01057-10, RP01057-20, RP01057-50, RP01057-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Frizzled-5/FZD5 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Pro167) of human Frizzled-5 (Accession #NP_003459.2.) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: FZD5, C2orf31, HFZ5
SWISS: Q13467
GeneID: 7855
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only