Recombinant Human Granzyme B/CTLA-1/GZMB Protein
Sizes: 10ug, 20ug
Catalogue Number: RP02860-10, RP02860-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Granzyme B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly19-Tyr247) of human Granzyme B (Accession #NP_004122.1) fused with a 6×His tag at the C-terminus.
Alternate Names: C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1; GZMB
SWISS: P10144
GeneID: 3002
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Granzyme B, also known as GZMB, is the most prominent member of the granzyme family of cell death-inducing serine proteases expressed in the granules of cytotoxic T lymphocytes (CTLs) and NK cells. Granzyme B enters the target cells depending on another membrane-binding granule protein, perforin, results in the activation of effector caspases and mitochondrial depolarization through caspase-dependent and -independent pathways, and consequently induces rapid cell apoptosis. Over 3 substrates of GZMB have been identified including the key substrate caspase-3, ICAD, and Bid. GZMB is suggested to protect the host by lysing cells bearing on their surface 'nonself' antigens such as bacterial and viral infected-cells and tumor cells and accordingly plays an essential role in immunosurveillance.
Bio-Activity: Measured by its ability to cleave a peptide substrate, tButyloxycaronylAlaAlaAspThioBenzylester (BocAADSBzl),in the presence of 5,5’Dithiobis (2nitrobenzoic acid) (DTNB). The specific activity is >1500 pmol/min/μg. (The enzyme needs to be activated by Recombinant Mouse Active Cathepsin C)
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only