WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human HB-EGF Protein - RP00754

Recombinant Human HB-EGF Protein - RP00754

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Human HB-EGF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00754-10, RP00754-20, RP00754-50, RP00754-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human HB-EGF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Leu20-Leu148) of human HB-EGF (Accession #Q99075) fused with a 6×His tag at the C-terminus.

Alternate Names: DTR, DTS, DTSF, HEGFL, HBEGF, DTS, DTSF, HEGFL; HB-EGF

SWISS: Q99075

GeneID: 1839

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Heparin-binding EGF-like growth factor (HB-EGF) is a 12-16 kDa member of the epidermal growth factor (EGF)family. It possesses an EGF-like domain, and a heparin-binding motif. Mature HB-EGF is a soluble peptide thatarises from proteolytic processing of the transmembrane form. Human HB -EGF shows 76% and 73% aasequence identity with rat and mouse HB-EGF, respectively. It is required for normal cardiac valve formationand normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB-EGF classified as agroup 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activityassociated with ErbB4 binding appears to be limited to non -mitogenic actions, while EGFR binding inducesboth mitogenic and non-mitogenic activity.

Bio-Activity: Measured in a cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED50 for this effect is 0.15-0.60 ng/mL, corresponding to a specific activity of 1.67×10^6 ~6.67×10^6 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only