Recombinant Human HHG-3/DHH Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01758-10, RP01758-20, RP01758-50, RP01758-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human HHG-3/DHH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys23-Gly198) of human HHG-3/DHH (Accession #NP_066382.1) fused with a 6×His tag at the N-terminus.
Alternate Names: GDMN; GDXYM; HHG-3; SRXY7; HHG-3; DHH
SWISS: O43323
GeneID: 50846
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Desert Hedgehog (Dhh) belongs to the highly conserved Hedgehog family of proteins which are involved in multiple developmental processes. Desert Hedgehog is a secreted, 45 kDa, 373 amino acid (aa) protein that undergoes autocatalytic cleavage between Gly198 and Cys199 catalyzed by the C-terminal domain, which releases the N-terminal domain with a concominant attachment of cholesterol at its new C-terminus. In addition to the C-terminally attached cholesterol, a fatty acid acyl chain is esterified to the N-terminal cysteine (aa 23) via an amide linkage. The 19 kDa N-terminal signaling domain is membrane associated due to its double lipid modifications. Its binding to Patched receptors results in the loss of Patched repression of Smoothened signaling (1 - 4). Dhh binds both Patched and Patched 2 as well as Hedgehog interacting protein (Hip) (5). Within the N-terminal domain, human Dhh shares 97% aa sequence identity with mouse and rat Dhh. It shares approximately 75% aa seqeuence identity with human Indian (Ihh) and Sonic Hedgehog (Shh) (5). Dhh is produced by Sertoli cells and is required for testis development and spermatogenesis (6, 7). It induces steroidogenic factor 1, which is instrumental in promoting Leydig cell differentiation (8, 9).
Source: E. coli
Tag: N-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,1mM DTT, pH 7.4.
Antigen Sequence: CGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only