WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IFN-alpha 6 Protein - RP00540

Recombinant Human IFN-alpha 6 Protein - RP00540

Regular price
$350.00
Regular price
Sale price
$350.00
Unit price
per 
Availability
Sold out

Recombinant Human IFN-alpha 6 Protein

Sizes: 50ug, 100ug

Catalogue Number: RP00540-50, RP00540-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IFN-alpha 6 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ser21-Glu189) of human IFNA6/IFN-alpha 6/LeIF K (Accession #P05013) fused with a 6×His tag at the C-terminus.

Alternate Names: IFNA6, IFN-alphaK

SWISS: P05013

GeneID: 3443

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interferon α-6 (IFN-α6) is a secreted protein which belongs to the α/β interferon family. IFN-α6 is produced bymacrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-α6 contains interferonalpha, beta and delta domain. IFN- α has antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase.

Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.12‑0.48 ng/mL, corresponding to a specific activity of 2.50×10^6 ~8.33×10^6 units/mg.

Source: HEK293 cells

Tag: C-6×His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only