Recombinant Human IFN-alpha G/IFNA5 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01915-10, RP01915-20, RP01915-50, RP01915-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human interferon-alpha/IFNA5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu22-Glu189) of Human interferon-alpha/IFNA5 (Accession #NP_002160.1) fused with a His tag at the C-terminus.
Alternate Names: Ifa5; IFNA5; IFNalpha G; IFN-alpha G; IFN-alpha-5; IFN-alphaG; INFA5; interferon alpha-5; Interferon alpha-61; Interferon alpha-G; interferon, alpha 5; LeIF G
SWISS: P01569
GeneID: 3442
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases suggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.
Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 3.27‑13.06 ng/mL, corresponding to a specific activity of 7.66×10^4 ~3.06×10^5 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only