Recombinant Human IFN-alpha H2/IFNA14 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01897-10, RP01897-20, RP01897-50, RP01897-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-alpha H2/IFNA14 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Asp189) of Human IFN-alpha H2/IFNA14 (Accession #NP_002163.2) fused with a His tag at the C-terminus.
Alternate Names: Interferon alpha-14, IFN-alpha-14, Interferon alpha-H, LeIF H, Interferon lambda-2-H, IFNA14
SWISS: P01570
GeneID: 3448
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early ‘80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology. Structurally, type I IFNs belong to the class of five helicalbundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds. The extracellular domain (ECD) of mature human IFNA14, shares 58% aa sequence identity with mouse IFNA14. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alphasubunit) and IFNAR2 (beta-subunit). Individual IFNA subtypes are known to display unique efficacies to viral protection, and IFNA14 has been shown to be a strong inducer of IFN-stimulated genes and anti-viral protection. IFNA14 has been shown to be potent against HIV-1 by upregulating the transcription of two intrinsic restriction factors with well-established anti-HIV-1 activity, MX2 and tetherin.
Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.47‑1.88 ng/mL, corresponding to a specific activity of 5.32×10^5 ~2.13×10^6 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only