Recombinant Human IFN-gamma Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01038-20, RP01038-50, RP01038-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-gamma Protein is produced by E. coli expression system. The target protein is expressed with sequence ( Gln24-Gln166) of human Interferon Gamma (Accession #NP_000610.2).
Alternate Names: IFNG, IFG, IFI
SWISS: P01579-1
GeneID: 3458
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human FNGR1/CD119 at 1 μg/mL (100 μL/well) can bind Human IFNG with a linear range of 0.98-1.97 ng/mL.|2.Measured in a cytotoxicity assay using HT-29 cells. The ED50 for this effect is 0.74-2.96 ng/mL, corresponding to a specific activity of 3.38×10^5 ~1.35×10^6 units/mg. 3.Flow cytometry: 1X10^6 A549 cells treated with IFN-γ (RP01038,1 ng/mL) were surface-stained with PE Rabbit IgG isotype control (A24172,5 μl/Test,left) or PE Rabbit anti-Human PD-L1/CD274 mAb (A26692,5 μl/Test,right).|4.Flow cytometry: 1X10^6 NCI-H460 cells treated with IFN-γ (RP01038,1 ng/mL) were surface-stained with PE Rabbit IgG isotype control (A24172,5 μl/Test,left) or PE Rabbit anti-Human PD-L1/CD274 mAb (A26692,5 μl/Test,right)
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only