Recombinant Human IFN-lambda 1/IL-29 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00977-10, RP00977-20, RP00977-50, RP00977-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IFN-lambda 1/IL-29 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly20-Thr200) of human IL-29 (Accession #NP_742152.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IFNL1, IL-29, IL29
SWISS: Q8IU54
GeneID: 282618
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is also known as cytokine Zcyto21, Interferon lambda-1, IFN-lambda-1, and IFNL1, is a secreted protein which belongs to the IL-28 / IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-1 receptor beta (IL-1Rbeta) and an orphan class II receptor chain, designated IL-28Ralpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL1RB and IL28RA. The ligand / receptor complex seems to signal through the Jak-STAT pathway.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Endotoxin: Please contact us for more information.
Research Use Only