WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IGFBP-7 Protein - RP02738

Recombinant Human IGFBP-7 Protein - RP02738

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human IGFBP-7 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02738-10, RP02738-20, RP02738-50, RP02738-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IGFBP-7 Protein Protein is expressed from Expi293 with His tag at the N-terminal.; It contains Asp30-Leu282

Alternate Names: IGFBP-7; IBP7; AGM; FSTL2; IGFBP-7v; IGFBPRP1; MAC25; PSF; RAMSVPS; TAF; IGFBP7; igfbp7

SWISS: Q16270

GeneID: 3490

Species: Human

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IGFBP-7, also known as Mac25/Angiomodulin (AGM), GFBP-rp1, tumor-derived adhesion factor (TAF) and prostacyclin-stimulating factor (PSF), is a secreted protein that contains three protein domain modules. Human IGFBP-rp1 cDNA encodes 282 amino acid (aa) residue precursor protein with a putative 26 aa signal peptide. IGFBP-7 binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized human IGFBP7 (Catalog: RP02738) at 2 μg/mL (100 μL/well) can bind human CD93 (Catalog: RP00164) with a linear range of 0.17-290.4 ng/mL.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only