Recombinant Human IgG2 Protein
Sizes: 50ug, 100ug
Catalogue Number: RPT0005-50, RPT0005-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IgG2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys326) of human IgG2A (Accession # P01859) fused with no tag.
Alternate Names: IGHG2; Immunoglobulin heavy constant gamma 2; IgG2
SWISS: P01859
GeneID: 3501
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human CD32a (Catalog: RP00081) at 2 μg/mL (100 μL/well) can bind Human IgG2 (Catalog: RPT0005) with a linear range of 1.2-338 ng/mL.
Source: HEK293 cells
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only