Recombinant Human IHH Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01672-10, RP01672-20, RP01672-50, RP01672-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IHH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys28-Gly202(Cys28Ile-Ile) (N-Met) ) of human IHH (Accession #NP_002172.2) fused with no additional amino acid.
Alternate Names: BDA1; HHG2; IHH
SWISS: Q14623
GeneID: 3549
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: By Similarity2 Publications Indian hedgehog protein N-product The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development.
Source: E. coli
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only