Recombinant Human IL-21R/CD360 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP00177-50, RP00177-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-21R/CD360 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Cys20-Pro236) of human IL-21R/Interleukin-21 Receptor (Accession #NP_068570.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL21R, CD360, NILR
SWISS: Q9HBE5
GeneID: 50615
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-21 receptor, also known as IL-21 receptor, IL-21R, Novel interleukin receptor, IL21R and NILR, is a single-pass type I membrane protein which belongs to the type I cytokine receptor family and Type 4 subfamily. Interleukin-21 (IL-21) belongs to a family of cytokines ,and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL21R at 2 μg/mL (100 μL/well) can bind Recombinant Human IL-21 with a linear range of 0.128-5.63 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only