Recombinant Human IL-22RA2/IL22BP Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00192-10, RP00192-20, RP00192-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-22RA2/IL22BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr22-Pro231) of human IL-22BP/IL-22RA2 (Accession #NP_851826.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL22RA2, CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16
SWISS: Q969J5-2
GeneID: 116379
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin 22 binding protein (IL-22BP), also known as CRF2-10, CRF2-X, and IL-22RA2, is a 35-45 kDa secreted glycoprotein in the type II cytokine receptor family (CRF). IL-22BP specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor.IL-22BP is produced by dendritic cells (DC), epithelial cells, activated B cells, and activated monocytes. It is constitutively expressed by DC but is down-regulated during local inflammation and in response to tissue damage. IL-22BP is critical for limiting IL-22 induced epithelial cell proliferation during wound healing, and its deficiency can enable uncontrolled proliferation and enhance tumor development.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL22 at 2 μg/mL (100 μL/well) can bind recombinant Human IL22BP, the EC50 of Human IL22BP is 10.78 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only