Recombinant Human IL-25/IL-17E Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01927-10, RP01927-20, RP01927-50, RP01927-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-25/IL-17E Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr33-Gly177) of Human IL-25/IL-17E (Accession #NP_073626.1) fused with a His tag at the N-terminus.
Alternate Names: IL17E; IL-17E; IL25; IL-25; interleukin 25; Interleukin-17E; interleukin-25
SWISS: Q9H293
GeneID: 64806
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17–producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity. IL-25 promotes cell expansion and Th2 cytokine production when Th2 central memory cells are stimulated with thymic stromal lymphopoietin (TSLP)–activated dendritic cells (DCs), homeostatic cytokines, or T cell receptor for antigen triggering. Elevated expression of IL-25 and IL-25R transcripts was observed in asthmatic lung tissues and atopic dermatitis skin lesions, linking their possible roles with exacerbated allergic disorders. A plausible explanation that IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of adaptive Th2 memory cells had been provided.
Bio-Activity: Measured by its ability to induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 5.46-21.84ng/mL, corresponding to a specific activity of 4.58×10^4 ~1.83×10^5 units/mg.
Source: HEK293 cells
Tag: N-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only