Recombinant Human IL-3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01362-10, RP01362-20, RP01362-50, RP01362-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala20-Phe152) of human interleukin-3/IL-3 (Accession #NP_000579.2) fused with a 6×His tag at the C-terminus.
Alternate Names: IL3, IL-3, MCGF, MULTI-CSF
SWISS: P08700
GeneID: 3562
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
Bio-Activity: 1.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.5-6 ng/mL.|2.Recombinant Human TPO(50 ng/mL, Cat. RP00174) , IL-3(15 ng/mL), IL-6(15 ng/mL, Cat. RP00201) and IL-11(15 ng/mL, Cat. RP00050) induce hematopoietic stem and progenitor cells to differentiate into megakaryocytes. After 6 days, the induction of CD41/42+ megakaryocytes was successful.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only