Recombinant Human IL-36 alpha/IL-1F6 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00027-10, RP00027-20, RP00027-50, RP00027-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-36 alpha/IL-1F6 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe158) of human IL-36 alpha (Accession #NP_055255.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL36A, FIL1, FIL1(EPSILON), FIL1E, IL-1F6, IL1(EPSILON), IL1F6
SWISS: Q9UHA7
GeneID: 27179
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-1 family member 6 (IL-1F6), also known as interleukin 36, alpha (IL36A), is a pro-inflammatory cytokine which plays an important role in innate and adaptive immunity.IL-1F6 can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this protein has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only