WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IL-36 alpha/IL-1F6 Protein - RP00027

Recombinant Human IL-36 alpha/IL-1F6 Protein - RP00027

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human IL-36 alpha/IL-1F6 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00027-10, RP00027-20, RP00027-50, RP00027-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-36 alpha/IL-1F6 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe158) of human IL-36 alpha (Accession #NP_055255.1) fused with a 6×His tag at the C-terminus.

Alternate Names: IL36A, FIL1, FIL1(EPSILON), FIL1E, IL-1F6, IL1(EPSILON), IL1F6

SWISS: Q9UHA7

GeneID: 27179

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin-1 family member 6 (IL-1F6), also known as interleukin 36, alpha (IL36A), is a pro-inflammatory cytokine which plays an important role in innate and adaptive immunity.IL-1F6 can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this protein has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only