Recombinant Human IL-37/IL-1F7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00409-10, RP00409-20, RP00409-50, RP00409-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-37/IL-1F7 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys27-Asp192) of human Interleukin-37/IL-37 (Accession #Q9NZH6-2) fused with No tag.
Alternate Names: IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H, IL-1H4, IL-1RP1, IL-37, IL1F7, IL1H4, IL1RP1
SWISS: Q9NZH6-2
GeneID: 27178
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: NLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only