Recombinant Human IL-3RA/CD123 Protein
Sizes: 10ug, 20ug
Catalogue Number: RP00121-10, RP00121-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-3RA/CD123 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys20-Arg305) of human IL3RA/CD123 (Accession #NP_002174.1) fused with a 6×His tag at the C-terminus.
Alternate Names: IL3RA, CD123, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
SWISS: P26951
GeneID: 3563
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL3 at 4 μg/mL (100 μL/well) can bind recombinant Human IL3RA, the EC50 of Human IL3RA is 5.3 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only