WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human IL-7RA/CD127 Protein - RP00976

Recombinant Human IL-7RA/CD127 Protein - RP00976

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human IL-7RA/CD127 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00976-10, RP00976-20, RP00976-50, RP00976-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human IL-7RA/CD127 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu21-Gly236) of human IL7R alpha (Accession #NP_002176.2) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: CD127, CDW127, IL-7R-alpha, IL7RA, ILRA, IL7R, CDW127, IL-7R-alpha, IL7RA, ILRA

SWISS: P16871-1

GeneID: 3575

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein also known as CD127, is a 75 kDa hematopoietin receptor superfamily member that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7 receptor alpha (CD127) signaling is essential for T-cell development and regulation of naive and memory T-cell homeostasis. IL-7RA is critically required for the proper development and function of lymphoid cells. Studies from both pathogenic and controlled HIV infection indicate that the containment of immune activation and preservation of CD127 expression are critical to the stability of CD4(+) T cells in infection. Factors relevant to HIV infection that could potentially decrease CD127 expression on human CD8(+) T cells. CD127 down-regulation may be an important contributor to HIV-associated T-cell dysfunction. In addition to IL-7, IL-7RA also associates with TSLPR to form the functional receptor for thymic stromal lymphopoietin (TSLP) which indirectly regulates T cell development by modulating dendritic cell activation. Mutations in the human IL-7RA gene cause a type of severe combined immunodeficiency in which the major deficiencies are in T cell development, whereas B and NK cells are relatively normal in number. Variation in the IL7RA gene was recently found associated with multiple sclerosis (MS). Soluble CD127 (sCD127) appears to play an important role in the immunopathogenesis of several chronic infections, multiple sclerosis, and various cancers.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL7 at 2 μg/mL (100 μL/well) can bind Recombinant Human IL7R alpha, the EC50 of Recombinant Human IL7R alpha is 48.44 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized CD127 Mouse mAb at 1μg/mL (25 μL/well) can bind Human CD34 with a linear range of 0.46-5.89ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only