Recombinant Human IL-9 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01686-10, RP01686-20, RP01686-50, RP01686-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ile144) of human IL9 (Accession #NP_000581.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: P40; HP40; IL-9; IL9
SWISS: P15248
GeneID: 3578
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
Bio-Activity: Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. Avanzi, G. et al. (1988) Br. J. Haematol. 69:359. The ED50 for this effect is 0.48-1.91 ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only