Recombinant Human JAM-B/VE-JAM/CD322 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01184-10, RP01184-20, RP01184-50, RP01184-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human JAM-B/VE-JAM/CD322 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Asn236) of human JAM-B/VE-JAM (Accession #NP_067042.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: JAM2, C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
SWISS: P57087
GeneID: 58494
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only