Recombinant Human L-Selectin/SELL/CD62L Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00255-20, RP00255-50, RP00255-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human L-Selectin/SELL/CD62L Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp52-Asn345) of human L-Selectin/CD62L (Accession #NP_000646.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: SELL, CD62L, LAM1, LECAM1, LEU8, LNHR, LSEL, LYAM1, PLNHR, TQ1
SWISS: P14151-2
GeneID: 6402
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only