Recombinant Human LAG-3/CD223 Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP00193-10, RP00193-50, RP00193-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LAG-3/CD223 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu23-Leu450) of human LAG-3/CD223 (Accession #NP_002277.4) fused with a 6×His tag at the C-terminus.
Alternate Names: LAG3, CD223
SWISS: Â P18627-1
GeneID: 3902
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human LAG3 at 2 μg/mL (100 μL/well) can bind Anti-LAG3 antibody with a linear range of 13-40 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human FGL1 at 5 μg/mL (100 μL/well) can bind recombinant Human LAG3, the EC50 of Human LAG3 is 0.32 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only