Recombinant Human LILRA1/LIR-6/CD85i Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01457-10, RP01457-20, RP01457-50, RP01457-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LILRA1/LIR-6/CD85i Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro17-Asn461) of human LILRA1/CD85i/LIR-6 (Accession #NP_006854.1) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: LILRA1, CD85I, LIR-6, LIR6
SWISS: O75019
GeneID: 11024
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. Some LILRs are extensively polymorphic, and exhibit evidence for balancing selection and association with disease susceptibility. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, mannitol and 0.01% Tween80.
Antigen Sequence: PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only