WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human LILRA2/ILT-1/CD85h Protein - RP01332

Recombinant Human LILRA2/ILT-1/CD85h Protein - RP01332

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human LILRA2/ILT-1/CD85h Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01332-10, RP01332-20, RP01332-50, RP01332-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LILRA2/ILT-1/CD85h Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24 -Asn449) of Human LILRA2 (Accession #NP_006857.2) fused with an 6×His tag at the C-terminus.

Alternate Names: LILRA2, CD85H, ILT1, LIR-7, LIR7

SWISS: Q8N149

GeneID: 11027

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: LILRA2 (Leukocyte immunoglobulin like receptor A2), also known as CD85H and LIR7 (Leukocyte immunoglobulin-like receptor 7).This encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses the innate immune response. It is an activating receptor highly expressed in inflammatory tissues and is involved in granulocyte and macrophage activation. LILRA2 is primarily expressed on the surface of cells of the innate immunity including monocytes, macrophages, neutrophils, basophils, and eosinophils but not on lymphocytes and NK cells. LILRA2 cross-linking on monocytes induces pro-inflammatory cytokines while inhibiting dendritic cell differentiation and antigen presentation. Diseases associated with LILRA2 include Tuberculoid Leprosy and Leprosy 3.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQC VSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDF LQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG PVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only