WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Lymphotactin/XCL1 Protein - RP02815

Recombinant Human Lymphotactin/XCL1 Protein - RP02815

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Lymphotactin/XCL1 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP02815-10, RP02815-20, RP02815-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Lymphotactin/XCL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val22-Gly114) of Human Lymphotactin/XCL1 (Accession #NP_002986.1) fused with a His tag at the C-terminus.

Alternate Names: XCL1, LTN, SCYC1, Lymphotactin, ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1

SWISS: P47992

GeneID: 6375

Species: Human

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1.

Source: HEK293 cells

Tag: C-6*His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only