WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human MERTK Protein - RP01183

Recombinant Human MERTK Protein - RP01183

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human MERTK Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01183-10, RP01183-20, RP01183-50, RP01183-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human MERTK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg26-Ala499) of human Mer/MERTK (Accession #NP_006334.2) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: MER, RP38, Tyro12, c-Eyk, c-mer, MERTK, RP38, Tyro12, c-Eyk, c-mer

SWISS: Q12866

GeneID: 10461

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human MERTK at 1 μg/mL (100 μL/well) can bind MERTK Rabbit mAb with a linear range of 0.2-3 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human Gas6 at 2 μg/mL (100 μL/well) can bind Human MERTK with a linear range of 1-210 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: REEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only