Recombinant Human MHC class I polypeptide-related sequence A/MIC-A Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00172-10, RP00172-20, RP00172-50, RP00172-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human MHC class I polypeptide-related sequence A/MIC-A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln308) of human MICA (Accession #NP_000238.1) fused with a 6×His tag at the C-terminus.
Alternate Names: MICA, MIC-A, PERB11.1, MHC class I polypeptide-related sequence A, MIC-A, PERB11.1
SWISS: Q29983
GeneID: 100507436
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: MHC class I chain-related molecules A (MICA) is one of the genes in the HLA class I region, which belongs to MHC class I family. It is the member of the non-classical class I family that displays the greatest degree of polymorphism. The MICA protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MICA Protein at 2 μg/mL (100 μL/well) can bind NKG2D with a linear range of 0.61-14.3 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only