Recombinant Human MITF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01520-10, RP01520-20, RP01520-50, RP01520-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human MITF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His402-Cys526) of human MITF (Accession #NP_000239.1) fused with a raFc tag at the N-terminus.
Alternate Names: CMM8, COMMAD, MI, WS2, WS2A, bHLHe32, MITF, COMMAD, MI, WS2, WS2A, bHLHe32
SWISS: O75030
GeneID: 4286
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Microphthalmia-associated transcription factor (MITF) is a member of the basic helix-loop-helix leucine zipper (bHLH-Zip) family and functions as the master regulator of the melanocytic lineage.MITF (Microphthalmia-associated transcription factor) is a lineage-specific transcription factor that plays a critical role in melanocyte homeostasis and whose deregulation has been shown to contribute to melanoma disease. Microphthalmia-associated transcription factor (MITF) is expressed in melanomas and has a critical role in melanocyte development and transformation. Because inhibition of MITF inhibits cell growth in melanoma, MITF is a potential therapeutic target molecule. Microphthalmia-associated transcription factor (MITF) regulates the transcription of its target genes by binding to their promoters. Microphthalmia-associated transcription factor (MITF) is a key regulator of differentiation of melanocytes and retinal pigment epithelial cells, but it also has functions in non-pigment cells.
Source: HEK293 cells
Tag: N-Rabbit Fc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: HGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only