Recombinant Human/Mouse/Rat BDNF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01243-10, RP01243-20, RP01243-50, RP01243-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human/Mouse/Rat BDNF Protein is produced by E. coli expression system. The target protein is expressed with sequence (His129-Arg247) of human BDNF (Accession #NP_733929.1.) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.
Alternate Names: ANON2, BULN2, BDNF, BULN2
SWISS: P23560-1
GeneID: 627
Species: Human,Mouse,Rat
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Brain-derived neurotrophic factor (BDNF) is a member of the nerve growth factor family.The neurotrophin family is comprised of at least four proteins including NGF, BDNF, NT-3, and NT-4/5. These secreted cytokines are synthesized as prepropeptides that are proteolytically processed to generate the mature proteins.BDNF cDNA encodes a 247 amino acid residue precursor protein with a signal peptide and a proprotein that are cleaved to yield the 119 amino acid residue mature BDNF. The amino acid sequence of mature BDNF is identical in all mammals examined. BDNF binds with high affinity and specifically activates the TrkB tyrosine kinase receptor.
Bio-Activity: 1.Immobilized Recombinant Human/Mouse/Rat BDNF Protein at 5μg/mL (100 μL/well) can bind Recombinant Human TrkB with a linear range of 0.38-1.14 μg/mL.2.Immobilized Recombinant Human/Mouse/Rat BDNF Protein at 1μg/mL (100 μL/well) can bind BDNF Rabbit mAb with a linear range of 0.4-2.15ng/mL.3.Immobilized Recombinant Human TrkB at 2μg/mL (100 μL/well) can bind Recombinant Human BDNF with a linear range of 1.95-258ng/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only