WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human/Mouse/Rat Mature BMP-4 Protein - RP02512S1

Recombinant Human/Mouse/Rat Mature BMP-4 Protein - RP02512S1

Regular price
$252.00
Regular price
Sale price
$252.00
Unit price
per 
Availability
Sold out

Recombinant Human/Mouse/Rat Mature BMP-4 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02512S1-10, RP02512S1-20, RP02512S1-50, RP02512S1-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human/Mouse/Rat Mature BMP-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-Arg408) of Human Mature BMP-4 (Accession #NP_001193.2) fused with no tag.

Alternate Names: BMP4, BMP2B, DVR4, Bone morphogenetic protein 4, BMP-4, Bone morphogenetic protein 2B, BMP-2B

SWISS: P12644

GeneID: 652

Species: Human,Mouse,Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Recombinant Human/Mouse/Rat Mature BMP-4 Protein that in humans is encoded by BMP4 gene. BMP4 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. BMP4 is highly conserved evolutionarily. BMP4 is found in early embryonic development in the ventral marginal zone and in the eye, heart blood and otic vesicle.

Bio-Activity: Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is 5.24-20.96 ng/mL, corresponding to a specific activity of 4.77×10^4 ~1.91×10^5 units/mg.

Source: CHO cells

Tag: No-Tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM acetic acid,pH3.6.

Antigen Sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only