Recombinant Human MUC-16/CA125 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01444-10, RP01444-20, RP01444-50, RP01444-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human MUC-16/CA125 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly12660-Met12923) of human CA125/MUC16 (Accession #NP_078966.2) fused with a Fc, Avi tag at the C-terminus.
Alternate Names: CA125, MUC16, mucin-16
SWISS: Q8WXI7
GeneID: 94025
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The CA125, also known as the MUC16, is a mucin protein that may be found in type I transmembrane or secreted forms that are used monitor the progress of epithelial ovarian cancer therapy. The CA 125 molecule is almost certainly a glycoprotein with a predominance of O-linkages. It is heterogeneous with regard to both size and charge, most likely due to continuous deglycosylation of side chains during its life-span in bodily fluids. It exists as a very large complex (perhaps as much as 4 million daltons) under natural conditions.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse Mesothelin/MSLN at 2 μg/mL (100 μL/well) can bind Human CA125 with a linear range of 0.01-0.72 ng/mL.
Source: HEK293 cells
Tag: C-hFc&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only