Recombinant Human MYDGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01790-10, RP01790-20, RP01790-50, RP01790-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human MYDGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Leu173) of human MYDGF (Accession #NP_061980.1) fused with a 6×His tag at the C-terminus.
Alternate Names: MYDGF, C19orf10, Myeloid-derived growth factor, MYDGF
SWISS: Q969H8
GeneID: 56005
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Myeloid-Derived Growth Factor, or MYDGF, is a Bone marrow-derived monocyte protein, and it is correlated with enhanced metabolic activity, suppression of apoptosis, and stimulation of cell proliferation. MYDGF is expressed predominantly in inflammatory cells, such as monocytes and macrophages. Up-regulation of MYDGF expression was also found during adipocyte differentiation. Expression of MYDGF was induced in the circulation and heart tissue after myocardial infarction. It promotes cardiac myocyte survival by stimulating endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway, and inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway. MYDGF was found over-expressed in approximately two-thirds of Hepatocellular Carcinoma (HCC) tissues, and its expression was significantly positively correlated with that of alpha-fetoprotein (AFP).
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only