WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human NBL1 Protein - RP02807

Recombinant Human NBL1 Protein - RP02807

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human NBL1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02807-10, RP02807-20, RP02807-50, RP02807-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human NBL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala17-Asp181) of human NBL1 (Accession #NP_005371.1) fused with a 6×His tag at the C-terminus.

Alternate Names: NB; DAN; NO3; DAND1; D1S1733E; NBL1

SWISS: P41271-1

GeneID: 4681

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The Dan (Differential screening-selected gene aberrative in neuroblastoma, also known as N03) gene was first identified as the putative rat tumor suppressor gene and encodes a protein structurally related to Cerberus and Gremlin in the vertebrates. It is a founding member of the DAN family of secreted proteins, acts as an inhibitor of cell cycle progression, and is closely involved in retinoic acid-induced neuroblastoma differentiation. There are at least five mammalian protein members in the evolutionarily conserved Dan family including DAN, Gremlin/DRM, Cer1 (Cerberus-related), Dante, and PRDC (protein related to DAN and Cerberus), and share the C-terminal cystine-knot motif. As a secreted glycoprotein, DAN is a member of a class of glycoproteins shown to be secreted inhibitors of the transforming growth factor-beta (TGF-beta) and bone morphogenic protein pathways. It binds to BMPs and preventing their interactions with signaling receptor complexes, and accordingly regulates the processes of embryonic development and tissue differentiation. DAN gene product may have an important role in the regulation of the entry of cells into the S phase. Besides, the DAN gene product possesses an ability to revert phenotypes of transformed rat fibroblasts and represents a candidate tumor suppressor gene for neuroblastoma.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only