Recombinant Human Nectin-2/PVRL2/CD112 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01346-10, RP01346-20, RP01346-50, RP01346-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Nectin-2/PVRL2/CD112 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln32-Leu360) of human Nectin-2/CD112/PVRL2 (Accession #NP_002847.1) fused with Fc, 6×His tag at the C-terminus.
Alternate Names: CD112, HVEB, PRR2, PVRL2, PVRR2, NECTIN2, HVEB, PRR2, PVRL2, PVRR2, nectin-2
SWISS: Q92692-2
GeneID: 5819
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cluster of Differentiation 112 (CD112), also known as poliovirus receptor related protein 2 (PVRL2 or PRR2), is a single-pass type I transmembrane glycoprotein belonging to the Immunoglobulin superfamily. CD112 protein also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and thus is involved in cell to cell spreading of these viruses. CD112 protein has been identified as the ligand for DNAM-1 (CD226), and the interaction of CD226/CD112 protein can induce NK cell- and CD8+?T cell-mediated cytotoxicity and cytokine secretion. CD112 has been regarded as a critical component in allergic reactions, and accordingly may function as a novel target for anti-allergic therapy.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD112(Catalog #RP01346) at 1 μg/mL (100 μL/well) can bind Human CD226 (Catalog #RP00283) with a linear range of 1.37-81.11 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only