Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01389-10, RP01389-20, RP01389-50, RP01389-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL3/CD158b2 (Accession #NP_056952.2) fused with a 6×His tag at the C-terminus.
Alternate Names: KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58
SWISS: P43628-1
GeneID: 3804
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Killer cell immunoglobulin-like receptor 2DL3, also known as CD158 antigen-like family member B2, KIR-23GB, Killer inhibitory receptor cl 2-3, MHC class I NK cell receptor, NKAT2a, NKAT2b, Natural killer-associated transcript 2, p58 natural killer cell receptor clone CL-6, p58.2 MHC class-I-specific NK receptor, CD158b2, and KIR2DL3, is a single-pass type I membrane protein which belongs to the immunoglobulin superfamily. KIR2DL3 contains 2 Ig-like C2-type (immunoglobulin-like) domains. KIR2DL3 interacts with ARRB2. KIR2DL3 is a receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3, and HLA-Cw7). KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human KIR2DL3 at 5 μg/mL (100 μL/well) can bind KIR2DL3 Rabbit pAb with a linear range of 1-39 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only