Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01452-10, RP01452-20, RP01452-50, RP01452-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL2 (Accession #NP_055034.2) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: KIR2DL2, CD158B1, CD158b, NKAT-6, NKAT6, p58.2
SWISS: P43627
GeneID: 3803
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: KIR2DL2 (2DL2, formerly NKAT6, designated CD158b) is a 348 amino acid (aa) type I transmembrane glycoprotein that belongs to the human killer cell Ig?like receptor (KIR) family. KIRs are expressed on human CD56dim NK cells and T cell subsets, and regulate effector functions in the innate immune system.KIR2DL2 is receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only