Recombinant Human NKG-2D/KLRK1/CD314 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01879-10, RP01879-20, RP01879-50, RP01879-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKG-2D/KLRK1/CD314 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (ILe73-Val216) of Human NKG-2D/KLRK1/CD314 (Accession #NP_001186734.1) fused with a hFc at the N-terminus.
Alternate Names: KLR; CD314; NKG2D; NKG2-D
SWISS: P26718
GeneID: 22914
Species: human
Purity: ≥ 85% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: NKG2D is a transmembrane protein belonging to the CD94/NKG2 family of C-type lectin-like receptors, also known as KLRK1, CD314, D12S2489E, KLR and killer cell lectin like receptor K1. NKG2D itself forms a homodimer whose ectodomains serve for ligand binding. NKG2D is a major recognition receptor for the detection and elimination of transformed and infected cells as its ligands are induced during cellular stress, either as a result of infection or genomic stress such as in cancer. In NK cells, NKG2D serves as an activating receptor, which itself is able to trigger cytotoxicity. The function of NKG2D on CD8+ T cells is to send co-stimulatory signals to activate them.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MICA(Catalog: RP00172) at 2 μg/mL (100 μL/well) can bind Human NKG-2D/KLRK1/CD314 (Catalog: RP01879) with a linear range of 0.005-0.98 μg/mL.
Source: HEK293 cells
Tag: N-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only