Recombinant Human NKG2-D/KLRK1/CD314 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00417-10, RP00417-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Phe78-Val216) of human NKG2D/CD314/KLRK1 (Accession #P26718) fused with a 6×His tag at the N-terminus.
Alternate Names: KLR; CD314; NKG2D; NKG2-D
SWISS: P26718
GeneID: 22914
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only