WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human NKG2-D/KLRK1/CD314 Protein - RP00417

Recombinant Human NKG2-D/KLRK1/CD314 Protein - RP00417

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human NKG2-D/KLRK1/CD314 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00417-10, RP00417-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Phe78-Val216) of human NKG2D/CD314/KLRK1 (Accession #P26718) fused with a 6×His tag at the N-terminus.

Alternate Names: KLR; CD314; NKG2D; NKG2-D

SWISS: P26718

GeneID: 22914

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only