WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human NKG2-D/KLRK1/CD314 Protein - RP01530

Recombinant Human NKG2-D/KLRK1/CD314 Protein - RP01530

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human NKG2-D/KLRK1/CD314 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01530-10, RP01530-20, RP01530-50, RP01530-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile73-Val216) of human NKG2-D/KLRK1/CD314 (Accession #NP_031386.2) fused with a raFc tag at the N-terminus.

Alternate Names: KLRK1, CD314, D12S2489E, KLR, NKG2-D, NKG2D

SWISS: P26718

GeneID: 22914

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: KLRK1 (Killer Cell Lectin Like Receptor K1) is a Protein Coding gene. NKG2D, also known as CD314, is an immune receptor that consists of two disulfide-linked type II transmembrane proteins with short intracellular proteins incapable to transduce signals. To transduce signals, NKG2D needs adaptor proteins and it uses two adaptor proteins, DAP10 and DAP12. These two adaptor proteins associate as homodimers to NKG2D- therefore the entire receptor complex appears as a hexamer. NKG2D can send co-stimulatory signals to activate CD8 T cells. NKG2D also plays an important role in viral control. Cellular stress can induce ligands for NKG2D which results in the cell susceptible to NK cell-mediated lysis.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized human MICA (Catalog: RP00172) at 2 μg/mL (100 μL/well) can bind NKG2D with a linear range of 0.61-205.43 ng/mL.

Source: HEK293 cells

Tag: N-Rabbit Fc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALY ASSFKGYIENCSTPNTYICMQRTV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only