Recombinant Human NKG2D ligand 1/ULBP1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01454-10, RP01454-20, RP01454-50, RP01454-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKG2D ligand 1/ULBP1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Pro215) of human ULBP1 (Accession #NP_079494.1) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: ULBP1, N2DL-1, NKG2DL1, RAET1I
SWISS: Q9BZM6
GeneID: 80329
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: UL16-binding proteins (ULBP) or retinoic acid early transcripts-1 (RAET1) are ligands to the activating receptor, NKG2D. Ten members of the human ULBP/RAET1 gene family have been identified to encode for potentially functional proteins, and have tissue-specific expressions. ULBP1, also known as RAET1I and NKG2DL1, together with at least ULBP 2 and 3, are well-known ligands for NKG2D, and activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. ULBP1 is expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver and bone marrow, as well as some tumor cells. As an unconventional member of the MHC class I family, ULBP1 function in immune responses, especially in cancer and infectious diseases. Unlike other ULBP members, ULBP1 is able to interact with soluble CMV glycoprotein UL16 in CMV infected cells. The interaction with UL16 blocked the interaction with the NKG2D receptor, and thus might escape the immune surveillance. Furthermore, UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface. The ULBP1 regulation may have implications for development of new therapeutic strategies against cancer cells.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ULBP1 (Catalog: RP01454) at 2μg/mL (100 μL/well) can bind NKG2D with a linear range of 1.95-9.36ng/mL.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only