Recombinant Human NKG2D ligand 3/ULBP3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00240-10, RP00240-20, RP00240-50, RP00240-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKG2D ligand 3/ULBP3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly27-Pro216) of human ULBP-3 (Accession #NP_078794) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: ULBP3
SWISS: Q9BZM4
GeneID: 79465
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: ULBP-3 is a member of a family of cell-surface proteins that function as ligands for human NKG2D. ULBP-3 has also been described under the names RaeT1N (retinoic acid early transcript), NKG2DL3, and ALCAN-gamma. The name ULBP-3 derives from the original identification of three proteins, ULBP-1, -2, and -3, as ligands for the human cytomegalovirus glycoprotein UL16; they were designated UL16 binding proteins (ULBP). The gene for ULBP-3 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. Amino acid sequence identity within this family ranges from 30-60%. These proteins are distantly related to MHC class I proteins, but they possess only the alpha 1 and alpha 2 Ig-like domains, and they have no capacity to bind peptide or interact with beta 2‑microglobulin. Some family members, including ULBP-3, are anchored to the membrane via a GPI-linkage, whereas others have transmembrane domains.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ULBP3 (Catalog: RP00240) Protein at 2 μg/mL (100 μL/well) can bind NKG2D-raFc (Catalog: RP01530) with a linear range of 9.8-2009.2 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only