WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Oncostatin-M/OSM Protein - RP00054

Recombinant Human Oncostatin-M/OSM Protein - RP00054

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Oncostatin-M/OSM Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00054-10, RP00054-20, RP00054-50, RP00054-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Oncostatin-M/OSM Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala26-Arg221) of human Oncostatin-M/OSM (Accession #NP_065391.1).

Alternate Names: OSM, oncostatin-M

SWISS: P13725

GeneID: 5008

Species: Human

Purity: ≥ 95% as determined by reducing SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family. The preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells.

Bio-Activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.8-3.2 ng/mL, corresponding to a specific activity of 3.12×10^5 -1.25×10^6 units/mg.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, 5% glycerol, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only