Recombinant Human OX-2/CD200 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00127-10, RP00127-20, RP00127-50, RP00127-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human OX-2/CD200 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln31-Gly232) of human CD200/OX-2 (Accession #NP_005935.4) fused with a 6×His tag at the C-terminus.
Alternate Names: CD200, MOX1, MOX2, MRC, OX-2
SWISS: P41217
GeneID: 4345
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD200 at 2 μg/mL (100 μL/well) can bind Human CD200R with a linear range of 0.058-8.34 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only