Recombinant Human PDGF-BB Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01763-10, RP01763-20, RP01763-50, RP01763-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human PDGF-BB Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser82-Thr190) of human PDGF-BB (Accession #NP_002599.1) fused with a additional amino acid free.
Alternate Names: SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2; PDGF subunit B; PDGF-BB; PDGFB
SWISS: P01127
GeneID: 5155
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Platelet-derived growth factor-B (PDGFB) is necessary for normal cardiovascular development. The administration of PDGFB alone normalized tumor vasculature by increasing periendothelial coverage and vascular functionality. Interestingly, this effect exerted by PDGFB was also observed in the presence of DAPT. So PDGFB is able to improve tumor vascularity and allows the anticancer action of DAPT in the tumor.
Bio-Activity: 1.Immobilized PDGF-BB (Catalog: RP01763) at 2 μg/mL (100 μL/well) can bind Human PDGFRB (Catalog: RP00126) with a linear range of 0.1-75.4 ng/mL.2.Recombinant Human PDGF-BB Protein was measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 2.09-8.36 ng/mL, corresponding to a specific activity of 1.20×105~4.78×105 units/mg.
Source: Pichia
Tag: No-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM NaAc, pH 4.5.
Antigen Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only